Lineage for d1ucva_ (1ucv A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 916791Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 916832Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 916862Protein Ephrin type-A receptor 8, C-terminal domain [101242] (1 species)
  7. 916863Species Human (Homo sapiens) [TaxId:9606] [101243] (1 PDB entry)
  8. 916864Domain d1ucva_: 1ucv A: [99191]

Details for d1ucva_

PDB Entry: 1ucv (more details)

PDB Description: sterile alpha motif (sam) domain of ephrin type-a receptor 8
PDB Compounds: (A:) ephrin type-a receptor 8

SCOPe Domain Sequences for d1ucva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gssgssgltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkil
gsiqtmraqltstqgsgpssg

SCOPe Domain Coordinates for d1ucva_:

Click to download the PDB-style file with coordinates for d1ucva_.
(The format of our PDB-style files is described here.)

Timeline for d1ucva_: