Lineage for d1ucva_ (1ucv A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 356780Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 356796Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (9 proteins)
  6. 356817Protein Ephrin type-A receptor 8, C-terminal domain [101242] (1 species)
  7. 356818Species Human (Homo sapiens) [TaxId:9606] [101243] (1 PDB entry)
  8. 356819Domain d1ucva_: 1ucv A: [99191]

Details for d1ucva_

PDB Entry: 1ucv (more details)

PDB Description: sterile alpha motif (sam) domain of ephrin type-a receptor 8

SCOP Domain Sequences for d1ucva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens)}
gssgssgltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkil
gsiqtmraqltstqgsgpssg

SCOP Domain Coordinates for d1ucva_:

Click to download the PDB-style file with coordinates for d1ucva_.
(The format of our PDB-style files is described here.)

Timeline for d1ucva_: