Class a: All alpha proteins [46456] (202 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (9 proteins) |
Protein Ephrin type-A receptor 8, C-terminal domain [101242] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101243] (1 PDB entry) |
Domain d1ucva_: 1ucv A: [99191] |
PDB Entry: 1ucv (more details)
SCOP Domain Sequences for d1ucva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens)} gssgssgltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkil gsiqtmraqltstqgsgpssg
Timeline for d1ucva_: