Lineage for d1ucra_ (1ucr A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439111Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (1 protein)
  6. 439112Protein Dissimilatory sulfite reductase DsvD [101049] (1 species)
  7. 439113Species Desulfovibrio vulgaris [TaxId:881] [101050] (1 PDB entry)
  8. 439114Domain d1ucra_: 1ucr A: [99188]

Details for d1ucra_

PDB Entry: 1ucr (more details), 1.2 Å

PDB Description: Three-dimensional crystal structure of dissimilatory sulfite reductase D (DsrD)

SCOP Domain Sequences for d1ucra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucra_ a.4.5.45 (A:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagkqaaa

SCOP Domain Coordinates for d1ucra_:

Click to download the PDB-style file with coordinates for d1ucra_.
(The format of our PDB-style files is described here.)

Timeline for d1ucra_: