SCOPe 2.08: Domain d1ucra_: 1ucr A:

Lineage for d1ucra_ (1ucr A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (2 proteins)
   automatically mapped to Pfam PF08679

6. Protein Dissimilatory sulfite reductase DsvD [101049] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [101050] (1 PDB entry)

8. Domain d1ucra_: 1ucr A: [99188]
   complexed with so4

Details for d1ucra_

PDB Entry: 1ucr, 1.2 Å

PDB Description: Three-dimensional crystal structure of dissimilatory sulfite reductase D (DsrD)

PDB Compounds: (A:) Protein dsvD

SCOPe Domain Sequences for d1ucra_:

Sequence; same for both SEQRES and ATOM records:

>d1ucra_ a.4.5.45 (A:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagkqaaa

Timeline for d1ucra_:

• d1ucra_ first appeared in SCOP 1.67
  
• d1ucra_ appears in SCOPe 2.07