SCOP 1.73: Domain d1uclb_: 1ucl B:

Lineage for d1uclb_ (1ucl B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)

8. Domain d1uclb_: 1ucl B: [99182]
   complexed with so4; mutant

Details for d1uclb_

PDB Entry: 1ucl, 1.82 Å

PDB Description: mutants of rnase sa

PDB Compounds: (B:) guanyl-specific ribonuclease sa

SCOP Domain Sequences for d1uclb_:

Sequence; same for both SEQRES and ATOM records:

>d1uclb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheyttitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

Timeline for d1uclb_:

• d1uclb_ first appeared in SCOP 1.67
  
• d1uclb_ appears in SCOP 1.71
  
• d1uclb_ appears in SCOP 1.75
  
• d1uclb_ appears in the current release, SCOPe 2.08