Lineage for d1ucla_ (1ucl A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170736Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2170737Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2170738Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2170891Protein RNase Sa [53935] (1 species)
  7. 2170892Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. 2170926Domain d1ucla_: 1ucl A: [99181]
    complexed with so4; mutant

Details for d1ucla_

PDB Entry: 1ucl (more details), 1.82 Å

PDB Description: mutants of rnase sa
PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1ucla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucla_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheyttitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d1ucla_:

Click to download the PDB-style file with coordinates for d1ucla_.
(The format of our PDB-style files is described here.)

Timeline for d1ucla_: