Lineage for d1ucla_ (1ucl A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595668Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 595669Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 595670Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 595788Protein RNase Sa [53935] (1 species)
  7. 595789Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
  8. 595821Domain d1ucla_: 1ucl A: [99181]

Details for d1ucla_

PDB Entry: 1ucl (more details), 1.82 Å

PDB Description: mutants of rnase sa

SCOP Domain Sequences for d1ucla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucla_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheyttitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1ucla_:

Click to download the PDB-style file with coordinates for d1ucla_.
(The format of our PDB-style files is described here.)

Timeline for d1ucla_: