Lineage for d1ucka_ (1uck A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 849710Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 849711Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 849712Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 849856Protein RNase Sa [53935] (1 species)
  7. 849857Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. 849885Domain d1ucka_: 1uck A: [99179]

Details for d1ucka_

PDB Entry: 1uck (more details), 1.8 Å

PDB Description: mutants of rnase sa
PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOP Domain Sequences for d1ucka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucka_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1ucka_:

Click to download the PDB-style file with coordinates for d1ucka_.
(The format of our PDB-style files is described here.)

Timeline for d1ucka_: