Lineage for d1ucka_ (1uck A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405195Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 405196Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 405197Family d.1.1.2: Bacterial ribonucleases [81307] (4 proteins)
  6. 405308Protein RNase Sa [53935] (1 species)
  7. 405309Species Streptomyces aureofaciens [TaxId:1894] [53936] (20 PDB entries)
  8. 405336Domain d1ucka_: 1uck A: [99179]

Details for d1ucka_

PDB Entry: 1uck (more details), 1.8 Å

PDB Description: Mutants of RNase Sa

SCOP Domain Sequences for d1ucka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucka_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnrestlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1ucka_:

Click to download the PDB-style file with coordinates for d1ucka_.
(The format of our PDB-style files is described here.)

Timeline for d1ucka_: