SCOP 1.67: Domain d1ucfa_: 1ucf A:

Lineage for d1ucfa_ (1ucf A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (8 PDB entries)

8. Domain d1ucfa_: 1ucf A: [99173]

Details for d1ucfa_

PDB Entry: 1ucf, 1.95 Å

PDB Description: The Crystal Structure of DJ-1, a Protein Related to Male Fertility and Parkinson's Disease

SCOP Domain Sequences for d1ucfa_:

Sequence; same for both SEQRES and ATOM records:

>d1ucfa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens)}
maskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
vkaplvlk

Timeline for d1ucfa_:

• d1ucfa_ is new in SCOP 1.67
  
• d1ucfa_ appears in SCOP 1.69
  
• d1ucfa_ appears in the current release, SCOPe 2.08