Lineage for d1uc9b2 (1uc9 B:89-280)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611545Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 611546Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 611756Family d.142.1.7: Lysine biosynthesis enzyme LysX ATP-binding domain [103281] (1 protein)
  6. 611757Protein Lysine biosynthesis enzyme LysX ATP-binding domain [103282] (1 species)
  7. 611758Species Thermus thermophilus [TaxId:274] [103283] (2 PDB entries)
  8. 611762Domain d1uc9b2: 1uc9 B:89-280 [99172]
    Other proteins in same PDB: d1uc9a1, d1uc9b1
    complexed with adp

Details for d1uc9b2

PDB Entry: 1uc9 (more details), 2.38 Å

PDB Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8

SCOP Domain Sequences for d1uc9b2:

Sequence, based on SEQRES records: (download)

>d1uc9b2 d.142.1.7 (B:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrlxxxxxxxxxx
xxxxxxkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntarggq
aencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdip
geilkyawslas

Sequence, based on observed residues (ATOM records): (download)

>d1uc9b2 d.142.1.7 (B:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvixxxxxxxxxxxxxxgf
qhqlfyiqeyvekpgrdirvfvvgeraiaaiyraencplteevarlsvkaaeavgggvva
vdlfesergllvnevnhtmefknsvhttgvdipgeilkyawslas

SCOP Domain Coordinates for d1uc9b2:

Click to download the PDB-style file with coordinates for d1uc9b2.
(The format of our PDB-style files is described here.)

Timeline for d1uc9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uc9b1