SCOP 1.69: Domain d1uc9a2: 1uc9 A:89-280

Lineage for d1uc9a2 (1uc9 A:89-280)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families)

5. Family d.142.1.7: Lysine biosynthesis enzyme LysX ATP-binding domain [103281] (1 protein)

6. Protein Lysine biosynthesis enzyme LysX ATP-binding domain [103282] (1 species)

7. Species Thermus thermophilus [TaxId:274] [103283] (2 PDB entries)

8. Domain d1uc9a2: 1uc9 A:89-280 [99170]
   Other proteins in same PDB: d1uc9a1, d1uc9b1

Details for d1uc9a2

PDB Entry: 1uc9, 2.38 Å

PDB Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8

SCOP Domain Sequences for d1uc9a2:

Sequence, based on SEQRES records:

>d1uc9a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrlxxxxxxxxxx
xxxxxxkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntarggq
aencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdip
geilkyawslas

Sequence, based on observed residues (ATOM records):

>d1uc9a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigxxxxxxxxxxxxxxx
xgfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyraencplteevarlsvkaaeavggg
vvavdlfesergllvnevnhtmefknsvhttgvdipgeilkyawslas

Timeline for d1uc9a2:

• d1uc9a2 first appeared in SCOP 1.67
  
• d1uc9a2 appears in SCOP 1.71
  
• d1uc9a2 appears in the current release, SCOPe 2.08