![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.6: Lysine biosynthesis enzyme LysX, N-terminal domain [102284] (1 protein) |
![]() | Protein Lysine biosynthesis enzyme LysX, N-terminal domain [102285] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102286] (2 PDB entries) |
![]() | Domain d1uc9a1: 1uc9 A:1-88 [99169] Other proteins in same PDB: d1uc9a2, d1uc9b2 |
PDB Entry: 1uc9 (more details), 2.38 Å
SCOP Domain Sequences for d1uc9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc9a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus} mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs rglaaaryltalgipvvnrpevieacgd
Timeline for d1uc9a1: