![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.7: Lysine biosynthesis enzyme LysX ATP-binding domain [103281] (2 proteins) automatically mapped to Pfam PF08443 automatically mapped to Pfam PF13535 |
![]() | Protein Lysine biosynthesis enzyme LysX ATP-binding domain [103282] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [103283] (2 PDB entries) |
![]() | Domain d1uc8b2: 1uc8 B:89-280 [99168] Other proteins in same PDB: d1uc8a1, d1uc8b1 |
PDB Entry: 1uc8 (more details), 2 Å
SCOPe Domain Sequences for d1uc8b2:
Sequence, based on SEQRES records: (download)
>d1uc8b2 d.142.1.7 (B:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrllaxxxxxxxx xxxxxxkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntarggq aencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdip geilkyawslas
>d1uc8b2 d.142.1.7 (B:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvixxxxxxxxxxxxgfqh qlfyiqeyvekpgrdirvfvvgeraiaaiyraencplteevarlsvkaaeavgggvvavd lfesergllvnevnhtmefknsvhttgvdipgeilkyawslas
Timeline for d1uc8b2: