Lineage for d1uc8b2 (1uc8 B:89-280)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978840Family d.142.1.7: Lysine biosynthesis enzyme LysX ATP-binding domain [103281] (2 proteins)
    automatically mapped to Pfam PF08443
    automatically mapped to Pfam PF13535
  6. 2978841Protein Lysine biosynthesis enzyme LysX ATP-binding domain [103282] (1 species)
  7. 2978842Species Thermus thermophilus [TaxId:274] [103283] (2 PDB entries)
  8. 2978844Domain d1uc8b2: 1uc8 B:89-280 [99168]
    Other proteins in same PDB: d1uc8a1, d1uc8b1

Details for d1uc8b2

PDB Entry: 1uc8 (more details), 2 Å

PDB Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8
PDB Compounds: (B:) lysine biosynthesis enzyme

SCOPe Domain Sequences for d1uc8b2:

Sequence, based on SEQRES records: (download)

>d1uc8b2 d.142.1.7 (B:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrllaxxxxxxxx
xxxxxxkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntarggq
aencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdip
geilkyawslas

Sequence, based on observed residues (ATOM records): (download)

>d1uc8b2 d.142.1.7 (B:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]}
kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvixxxxxxxxxxxxgfqh
qlfyiqeyvekpgrdirvfvvgeraiaaiyraencplteevarlsvkaaeavgggvvavd
lfesergllvnevnhtmefknsvhttgvdipgeilkyawslas

SCOPe Domain Coordinates for d1uc8b2:

Click to download the PDB-style file with coordinates for d1uc8b2.
(The format of our PDB-style files is described here.)

Timeline for d1uc8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uc8b1