Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) |
Family d.142.1.7: Lysine biosynthesis enzyme LysX ATP-binding domain [103281] (1 protein) |
Protein Lysine biosynthesis enzyme LysX ATP-binding domain [103282] (1 species) |
Species Thermus thermophilus [TaxId:274] [103283] (2 PDB entries) |
Domain d1uc8a2: 1uc8 A:89-280 [99166] Other proteins in same PDB: d1uc8a1, d1uc8b1 |
PDB Entry: 1uc8 (more details), 2 Å
SCOP Domain Sequences for d1uc8a2:
Sequence, based on SEQRES records: (download)
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus} kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrllaxxxxxxxx xxxxxxkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntarggq aencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdip geilkyawslas
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus} kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigxxxxxxxxxxxxxxg fqhqlfyiqeyvekpgrdirvfvvgeraiaaiyraencplteevarlsvkaaeavgggvv avdlfesergllvnevnhtmefknsvhttgvdipgeilkyawslas
Timeline for d1uc8a2: