Lineage for d1uc8a1 (1uc8 A:1-88)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392624Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 392625Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 392790Family c.30.1.6: Lysine biosynthesis enzyme LysX, N-terminal domain [102284] (1 protein)
  6. 392791Protein Lysine biosynthesis enzyme LysX, N-terminal domain [102285] (1 species)
  7. 392792Species Thermus thermophilus [TaxId:274] [102286] (2 PDB entries)
  8. 392793Domain d1uc8a1: 1uc8 A:1-88 [99165]
    Other proteins in same PDB: d1uc8a2, d1uc8b2

Details for d1uc8a1

PDB Entry: 1uc8 (more details), 2 Å

PDB Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8

SCOP Domain Sequences for d1uc8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus}
mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
rglaaaryltalgipvvnrpevieacgd

SCOP Domain Coordinates for d1uc8a1:

Click to download the PDB-style file with coordinates for d1uc8a1.
(The format of our PDB-style files is described here.)

Timeline for d1uc8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uc8a2