SCOPe 2.08: Domain d1uc8a1: 1uc8 A:1-88

Lineage for d1uc8a1 (1uc8 A:1-88)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.6: Lysine biosynthesis enzyme LysX, N-terminal domain [102284] (1 protein)

6. Protein Lysine biosynthesis enzyme LysX, N-terminal domain [102285] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102286] (2 PDB entries)

8. Domain d1uc8a1: 1uc8 A:1-88 [99165]
   Other proteins in same PDB: d1uc8a2, d1uc8b2

Details for d1uc8a1

PDB Entry: 1uc8, 2 Å

PDB Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8

PDB Compounds: (A:) lysine biosynthesis enzyme

SCOPe Domain Sequences for d1uc8a1:

Sequence; same for both SEQRES and ATOM records:

>d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
rglaaaryltalgipvvnrpevieacgd

Timeline for d1uc8a1:

• d1uc8a1 first appeared in SCOP 1.67
  
• d1uc8a1 appears in SCOPe 2.07