Lineage for d1uc7b_ (1uc7 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484117Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)
  7. 2484124Species Escherichia coli [TaxId:562] [102436] (5 PDB entries)
  8. 2484130Domain d1uc7b_: 1uc7 B: [99164]
    disulfide-linked complex with the N-terminal domain

Details for d1uc7b_

PDB Entry: 1uc7 (more details), 1.9 Å

PDB Description: Crystal structure of DsbDgamma
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1uc7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc7b_ c.47.1.1 (B:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
aqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
dtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
drqp

SCOPe Domain Coordinates for d1uc7b_:

Click to download the PDB-style file with coordinates for d1uc7b_.
(The format of our PDB-style files is described here.)

Timeline for d1uc7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uc7a_