Lineage for d1uc7a_ (1uc7 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833463Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 833513Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species)
  7. 833514Species Escherichia coli [TaxId:562] [102436] (6 PDB entries)
  8. 833519Domain d1uc7a_: 1uc7 A: [99163]
    disulfide-linked complex with the N-terminal domain

Details for d1uc7a_

PDB Entry: 1uc7 (more details), 1.9 Å

PDB Description: Crystal structure of DsbDgamma
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d1uc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc7a_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
aqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
dtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
drqp

SCOP Domain Coordinates for d1uc7a_:

Click to download the PDB-style file with coordinates for d1uc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1uc7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uc7b_