Lineage for d1uc2b_ (1uc2 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614943Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily)
    complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold
  4. 2614944Superfamily d.261.1: Hypothetical protein PH1602 [103365] (2 families) (S)
  5. 2614945Family d.261.1.1: Hypothetical protein PH1602 [103366] (2 proteins)
    automatically mapped to Pfam PF01139
  6. 2614946Protein Hypothetical protein PH1602 [103367] (1 species)
  7. 2614947Species Pyrococcus horikoshii [TaxId:53953] [103368] (5 PDB entries)
  8. 2614949Domain d1uc2b_: 1uc2 B: [99162]
    structural genomics
    complexed with so4, suc

Details for d1uc2b_

PDB Entry: 1uc2 (more details), 2.15 Å

PDB Description: hypothetical extein protein of ph1602 from pyrococcus horikoshii
PDB Compounds: (B:) hypothetical protein PH1602

SCOPe Domain Sequences for d1uc2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc2b_ d.261.1.1 (B:) Hypothetical protein PH1602 {Pyrococcus horikoshii [TaxId: 53953]}
vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg

SCOPe Domain Coordinates for d1uc2b_:

Click to download the PDB-style file with coordinates for d1uc2b_.
(The format of our PDB-style files is described here.)

Timeline for d1uc2b_: