![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily) complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold |
![]() | Superfamily d.261.1: Hypothetical protein PH1602 [103365] (2 families) ![]() |
![]() | Family d.261.1.1: Hypothetical protein PH1602 [103366] (2 proteins) automatically mapped to Pfam PF01139 |
![]() | Protein Hypothetical protein PH1602 [103367] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [103368] (5 PDB entries) |
![]() | Domain d1uc2a_: 1uc2 A: [99161] structural genomics complexed with so4 |
PDB Entry: 1uc2 (more details), 2.15 Å
SCOPe Domain Sequences for d1uc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc2a_ d.261.1.1 (A:) Hypothetical protein PH1602 {Pyrococcus horikoshii [TaxId: 53953]} vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg
Timeline for d1uc2a_: