Lineage for d1uc2a_ (1uc2 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily)
    complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold
  4. Superfamily d.261.1: Hypothetical protein PH1602 [103365] (2 families) (S)
  5. Family d.261.1.1: Hypothetical protein PH1602 [103366] (2 proteins)
    automatically mapped to Pfam PF01139
  6. Protein Hypothetical protein PH1602 [103367] (1 species)
  7. Species Pyrococcus horikoshii [TaxId:53953] [103368] (5 PDB entries)
  8. Domain d1uc2a_: 1uc2 A: [99161]
    structural genomics
    complexed with so4

Details for d1uc2a_

PDB Entry: 1uc2 (more details), 2.15 Å

PDB Description: hypothetical extein protein of ph1602 from pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein PH1602

SCOPe Domain Sequences for d1uc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc2a_ d.261.1.1 (A:) Hypothetical protein PH1602 {Pyrococcus horikoshii [TaxId: 53953]}
vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg

SCOPe Domain Coordinates for d1uc2a_ are not available.

Timeline for d1uc2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uc2b_