SCOP 1.71: Domain d1ubba_: 1ubb A:

Lineage for d1ubba_ (1ubb A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (11 PDB entries)

8. Domain d1ubba_: 1ubb A: [99160]
   complexed with hem

Details for d1ubba_

PDB Entry: 1ubb, 2.3 Å

PDB Description: Crystal structure of rat HO-1 in complex with ferrous heme

SCOP Domain Sequences for d1ubba_:

Sequence; same for both SEQRES and ATOM records:

>d1ubba_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus)}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

Timeline for d1ubba_:

• d1ubba_ first appeared in SCOP 1.67
  
• d1ubba_ appears in SCOP 1.69
  
• d1ubba_ appears in SCOP 1.73
  
• d1ubba_ appears in the current release, SCOPe 2.08