Lineage for d1ub6h1 (1ub6 H:2-116)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510779Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 1510793Domain d1ub6h1: 1ub6 H:2-116 [99155]
    Other proteins in same PDB: d1ub6a2, d1ub6b1, d1ub6b2, d1ub6h2, d1ub6l1, d1ub6l2
    part of blue fluorescent Fab 19G2

Details for d1ub6h1

PDB Entry: 1ub6 (more details), 2.12 Å

PDB Description: Crystal structure of Antibody 19G2 with sera ligand
PDB Compounds: (H:) antibody 19G2, alpha chain

SCOPe Domain Sequences for d1ub6h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub6h1 b.1.1.1 (H:2-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvsa

SCOPe Domain Coordinates for d1ub6h1:

Click to download the PDB-style file with coordinates for d1ub6h1.
(The format of our PDB-style files is described here.)

Timeline for d1ub6h1: