Lineage for d1ub5l2 (1ub5 L:114-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 549959Domain d1ub5l2: 1ub5 L:114-214 [99150]
    Other proteins in same PDB: d1ub5a1, d1ub5a2, d1ub5b1, d1ub5h1, d1ub5h2, d1ub5l1

Details for d1ub5l2

PDB Entry: 1ub5 (more details), 2 Å

PDB Description: Crystal structure of Antibody 19G2 with hapten at 100K

SCOP Domain Sequences for d1ub5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub5l2 b.1.1.2 (L:114-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhngytceathktstspivksf

SCOP Domain Coordinates for d1ub5l2:

Click to download the PDB-style file with coordinates for d1ub5l2.
(The format of our PDB-style files is described here.)

Timeline for d1ub5l2: