Lineage for d1ub5h1 (1ub5 H:1-116)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929818Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 929827Domain d1ub5h1: 1ub5 H:1-116 [99147]
    Other proteins in same PDB: d1ub5a2, d1ub5b1, d1ub5b2, d1ub5h2, d1ub5l1, d1ub5l2
    part of blue fluorescent Fab 19G2
    part of anti-testosterone Fab 77
    complexed with spb

Details for d1ub5h1

PDB Entry: 1ub5 (more details), 2 Å

PDB Description: Crystal structure of Antibody 19G2 with hapten at 100K
PDB Compounds: (H:) antibody 19G2, alpha chain

SCOPe Domain Sequences for d1ub5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub5h1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evkllesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityyp
dsvagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvss

SCOPe Domain Coordinates for d1ub5h1:

Click to download the PDB-style file with coordinates for d1ub5h1.
(The format of our PDB-style files is described here.)

Timeline for d1ub5h1: