Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
Domain d1ub5b2: 1ub5 B:114-214 [99146] Other proteins in same PDB: d1ub5a1, d1ub5a2, d1ub5b1, d1ub5h1, d1ub5h2, d1ub5l1 part of blue fluorescent Fab 19G2 |
PDB Entry: 1ub5 (more details), 2 Å
SCOP Domain Sequences for d1ub5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ub5b2 b.1.1.2 (B:114-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhngytceathktstspivksf
Timeline for d1ub5b2: