Lineage for d1ub5b1 (1ub5 B:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451743Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 451797Domain d1ub5b1: 1ub5 B:1-113 [99145]
    Other proteins in same PDB: d1ub5a1, d1ub5a2, d1ub5b2, d1ub5h1, d1ub5h2, d1ub5l2
    part of blue fluorescent Fab 19G2

Details for d1ub5b1

PDB Entry: 1ub5 (more details), 2 Å

PDB Description: Crystal structure of Antibody 19G2 with hapten at 100K

SCOP Domain Sequences for d1ub5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub5b1 b.1.1.1 (B:1-113) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divmtqaafsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnla
sgvpnrfsssgsgtdftlrisrveaedvgvyycaqnlelpptfgggtkleikr

SCOP Domain Coordinates for d1ub5b1:

Click to download the PDB-style file with coordinates for d1ub5b1.
(The format of our PDB-style files is described here.)

Timeline for d1ub5b1: