Lineage for d1ub5a2 (1ub5 A:117-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549286Domain d1ub5a2: 1ub5 A:117-214 [99144]
    Other proteins in same PDB: d1ub5a1, d1ub5b1, d1ub5b2, d1ub5h1, d1ub5l1, d1ub5l2
    part of blue fluorescent Fab 19G2
    complexed with spb

Details for d1ub5a2

PDB Entry: 1ub5 (more details), 2 Å

PDB Description: Crystal structure of Antibody 19G2 with hapten at 100K

SCOP Domain Sequences for d1ub5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub5a2 b.1.1.2 (A:117-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsgly
tmsssvtvpsstwpstvtcsvahpassttvdkkle

SCOP Domain Coordinates for d1ub5a2:

Click to download the PDB-style file with coordinates for d1ub5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ub5a2: