SCOP 1.69: Domain d1ub5a1: 1ub5 A:1-116

Lineage for d1ub5a1 (1ub5 A:1-116)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (16 PDB entries)

8. Domain d1ub5a1: 1ub5 A:1-116 [99143]
   Other proteins in same PDB: d1ub5a2, d1ub5b1, d1ub5b2, d1ub5h2, d1ub5l1, d1ub5l2
   part of blue fluorescent Fab 19G2

Details for d1ub5a1

PDB Entry: 1ub5, 2 Å

PDB Description: Crystal structure of Antibody 19G2 with hapten at 100K

SCOP Domain Sequences for d1ub5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ub5a1 b.1.1.1 (A:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
evkllesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityyp
dsvagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtlvtvss

Timeline for d1ub5a1:

• d1ub5a1 first appeared in SCOP 1.67
  
• d1ub5a1 appears in SCOP 1.71
  
• d1ub5a1 appears in the current release, SCOPe 2.08