Lineage for d1ub2a2 (1ub2 A:427-720)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445911Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 445912Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 446190Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 446191Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 446207Species Synechococcus sp. pcc 7942 [TaxId:1140] [101337] (1 PDB entry)
  8. 446209Domain d1ub2a2: 1ub2 A:427-720 [99142]

Details for d1ub2a2

PDB Entry: 1ub2 (more details), 2.4 Å

PDB Description: Crystal structure of catalase-peroxidase from Synechococcus PCC 7942

SCOP Domain Sequences for d1ub2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942}
qedliwqdpipagnrnydvqavkdriaasglsiselvstawdsartyrnsdkrggangar
irlapqkdwegnepdrlpkvlavlegisaatgatvadvivlagnvgveqkaraagveivl
pfapgrgdataeqtdtesfavlepihdaiatgssrtmrqrlknccliatqllgltapemt
vligglrvlgtnhggtkhvvftdregvltndffvnltdmnylwkpagknlyeicdrktnq
vkwtatrvdlvfgsnsilrayselyaqddnkekfvrdfvaawtkvmnadrfdld

SCOP Domain Coordinates for d1ub2a2:

Click to download the PDB-style file with coordinates for d1ub2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ub2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ub2a1