Lineage for d1ub2a1 (1ub2 A:21-426)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358328Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358329Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 358599Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 358600Protein Catalase-peroxidase KatG [74754] (3 species)
    only the N-terminal CCP-like domain binds heme
  7. 358611Species Synechococcus sp. pcc 7942 [TaxId:1140] [101337] (1 PDB entry)
  8. 358612Domain d1ub2a1: 1ub2 A:21-426 [99141]

Details for d1ub2a1

PDB Entry: 1ub2 (more details), 2.4 Å

PDB Description: Crystal structure of catalase-peroxidase from Synechococcus PCC 7942

SCOP Domain Sequences for d1ub2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942}
staewwpkalnldilsqhdrktnpmgpdfnyqeevqkldaalkqdlqalmtdsqdwwpad
wghygglmirltwhaagtyriadgrggagtgnqrfaplnswpdntnldkarrllwpikqk
ygnklswadliayagtiayesmglktfgfafgrediwhpekdiywgpekewfppstnpns
rytgdrelenplaavtmgliyvnpegvdgnpdplktahdvrvtfarmamndeetvaltag
ghtvgkchgngnaallgpepegadvedqglgwinktqsgigrnavtsglegawtphptqw
dngyfavcslnydwelkknpagawqwepinpreedlpvdvedpsirrnlvmtdadmamkm
dpeyrkiserfyqdpayfadvfarawfklthrdmgpkaryigpdvp

SCOP Domain Coordinates for d1ub2a1:

Click to download the PDB-style file with coordinates for d1ub2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ub2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ub2a2