Lineage for d1ub1a_ (1ub1 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499058Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 499059Superfamily d.10.1: DNA-binding domain [54171] (4 families) (S)
  5. 499073Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins)
  6. 499074Protein Methyl-CpG-binding protein 2, MECP2 [54179] (2 species)
  7. 499075Species Chicken (Gallus gallus) [TaxId:9031] [102734] (1 PDB entry)
  8. 499076Domain d1ub1a_: 1ub1 A: [99140]

Details for d1ub1a_

PDB Entry: 1ub1 (more details)

PDB Description: solution structure of the matrix attachment region-binding domain of chicken mecp2

SCOP Domain Sequences for d1ub1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub1a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Chicken (Gallus gallus)}
apavpeasaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgk
afrskveliayfekvgdtsldpndfdftvtgrgspsrreqrppkkakspkspgsgrgrgr
pkgsg

SCOP Domain Coordinates for d1ub1a_:

Click to download the PDB-style file with coordinates for d1ub1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ub1a_: