SCOPe 2.08: Domain d1ub1a_: 1ub1 A:

Lineage for d1ub1a_ (1ub1 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (5 families)

5. Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins)

6. Protein Methyl-CpG-binding protein 2, MECP2 [54179] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [102734] (1 PDB entry)

8. Domain d1ub1a_: 1ub1 A: [99140]
   has additional insertions and/or extensions that are not grouped together

Details for d1ub1a_

PDB Entry: 1ub1

PDB Description: solution structure of the matrix attachment region-binding domain of chicken mecp2

PDB Compounds: (A:) attachment region binding protein

SCOPe Domain Sequences for d1ub1a_:

Sequence; same for both SEQRES and ATOM records:

>d1ub1a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Chicken (Gallus gallus) [TaxId: 9031]}
apavpeasaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgk
afrskveliayfekvgdtsldpndfdftvtgrgspsrreqrppkkakspkspgsgrgrgr
pkgsg

Timeline for d1ub1a_:

• d1ub1a_ first appeared in SCOP 1.67
  
• d1ub1a_ appears in SCOPe 2.07