SCOPe 2.05: Domain d1uata_: 1uat A:

Lineage for d1uata_ (1uat A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Methylomonas sp. j [TaxId:32038] [49536] (2 PDB entries)

8. Domain d1uata_: 1uat A: [99138]
   complexed with cu, so4

Details for d1uata_

PDB Entry: 1uat, 1.9 Å

PDB Description: The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J

PDB Compounds: (A:) Azurin iso-2

SCOPe Domain Sequences for d1uata_:

Sequence; same for both SEQRES and ATOM records:

>d1uata_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]}
ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
mrgtlklee

Timeline for d1uata_:

• d1uata_ first appeared in SCOP 1.67
  
• d1uata_ appears in SCOPe 2.04
  
• d1uata_ appears in SCOPe 2.06
  
• d1uata_ appears in the current release, SCOPe 2.08