Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Azurin [49530] (6 species) |
Species Methylomonas sp. j [TaxId:32038] [49536] (2 PDB entries) |
Domain d1uata_: 1uat A: [99138] complexed with cu, so4 |
PDB Entry: 1uat (more details), 1.9 Å
SCOPe Domain Sequences for d1uata_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uata_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm mrgtlklee
Timeline for d1uata_: