Lineage for d1uata_ (1uat A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770506Species Methylomonas sp. j [TaxId:32038] [49536] (2 PDB entries)
  8. 2770508Domain d1uata_: 1uat A: [99138]
    complexed with cu, so4

Details for d1uata_

PDB Entry: 1uat (more details), 1.9 Å

PDB Description: The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J
PDB Compounds: (A:) Azurin iso-2

SCOPe Domain Sequences for d1uata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uata_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]}
ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
mrgtlklee

SCOPe Domain Coordinates for d1uata_:

Click to download the PDB-style file with coordinates for d1uata_.
(The format of our PDB-style files is described here.)

Timeline for d1uata_: