SCOPe 2.07: Domain d1uana_: 1uan A:

Lineage for d1uana_ (1uan A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.134: LmbE-like [102587] (1 superfamily)
   3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases

4. Superfamily c.134.1: LmbE-like [102588] (2 families)

5. Family c.134.1.1: LmbE-like [102589] (3 proteins)
   putative deacetylases

6. Protein Hypothetical protein TT1542 [102592] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102593] (1 PDB entry)

8. Domain d1uana_: 1uan A: [99135]
   structural genomics

Details for d1uana_

PDB Entry: 1uan, 2 Å

PDB Description: Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8

PDB Compounds: (A:) hypothetical protein TT1542

SCOPe Domain Sequences for d1uana_:

Sequence, based on SEQRES records:

>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]}
mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftge
aasetvgpkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra

Sequence, based on observed residues (ATOM records):

>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]}
mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftvg
pkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra

Timeline for d1uana_:

• d1uana_ first appeared in SCOP 1.67
  
• d1uana_ appears in SCOPe 2.06
  
• d1uana_ appears in the current release, SCOPe 2.08