Lineage for d1uana_ (1uan A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151803Fold c.134: LmbE-like [102587] (1 superfamily)
    3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases
  4. 2151804Superfamily c.134.1: LmbE-like [102588] (2 families) (S)
  5. 2151805Family c.134.1.1: LmbE-like [102589] (3 protein domains)
    putative deacetylases
  6. 2151814Protein Hypothetical protein TT1542 [102592] (1 species)
  7. 2151815Species Thermus thermophilus [TaxId:274] [102593] (1 PDB entry)
  8. 2151816Domain d1uana_: 1uan A: [99135]
    structural genomics

Details for d1uana_

PDB Entry: 1uan (more details), 2 Å

PDB Description: Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TT1542

SCOPe Domain Sequences for d1uana_:

Sequence, based on SEQRES records: (download)

>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]}
mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftge
aasetvgpkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra

Sequence, based on observed residues (ATOM records): (download)

>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]}
mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr
ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava
avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftvg
pkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra

SCOPe Domain Coordinates for d1uana_:

Click to download the PDB-style file with coordinates for d1uana_.
(The format of our PDB-style files is described here.)

Timeline for d1uana_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uanb_