![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.134: LmbE-like [102587] (1 superfamily) 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases |
![]() | Superfamily c.134.1: LmbE-like [102588] (2 families) ![]() |
![]() | Family c.134.1.1: LmbE-like [102589] (3 proteins) putative deacetylases |
![]() | Protein Hypothetical protein TT1542 [102592] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102593] (1 PDB entry) |
![]() | Domain d1uana_: 1uan A: [99135] structural genomics |
PDB Entry: 1uan (more details), 2 Å
SCOPe Domain Sequences for d1uana_:
Sequence, based on SEQRES records: (download)
>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]} mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftge aasetvgpkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra
>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]} mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasr ilgldfrgnlgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlava avhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftvg pkgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra
Timeline for d1uana_: