Lineage for d1uacy_ (1uac Y:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2495039Family d.2.1.2: C-type lysozyme [53960] (3 protein domains)
    automatically mapped to Pfam PF00062
  6. 2495103Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 2496168Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 2496172Domain d1uacy_: 1uac Y: [99134]
    Other proteins in same PDB: d1uach1, d1uach2, d1uacl_
    mutant

Details for d1uacy_

PDB Entry: 1uac (more details), 1.7 Å

PDB Description: crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme
PDB Compounds: (Y:) Lysozyme C

SCOPe Domain Sequences for d1uacy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uacy_ d.2.1.2 (Y:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOPe Domain Coordinates for d1uacy_:

Click to download the PDB-style file with coordinates for d1uacy_.
(The format of our PDB-style files is described here.)

Timeline for d1uacy_: