Lineage for d1uach_ (1uac H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511324Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 1511325Domain d1uach_: 1uac H: [99132]
    Other proteins in same PDB: d1uacl_, d1uacy_
    part of Fv HyHEL-10
    mutant

Details for d1uach_

PDB Entry: 1uac (more details), 1.7 Å

PDB Description: crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d1uach_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uach_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvssfgstfyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d1uach_:

Click to download the PDB-style file with coordinates for d1uach_.
(The format of our PDB-style files is described here.)

Timeline for d1uach_: