SCOP 1.69: Domain d1ua6l_: 1ua6 L:

Lineage for d1ua6l_ (1ua6 L:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)

8. Domain d1ua6l_: 1ua6 L: [99130]
   Other proteins in same PDB: d1ua6h_, d1ua6y_
   part of Fv HyHEL-10

Details for d1ua6l_

PDB Entry: 1ua6, 1.9 Å

PDB Description: crystal structure of hyhel-10 fv mutant sfsf complexed with hen egg white lysozyme complex

SCOP Domain Sequences for d1ua6l_:

Sequence; same for both SEQRES and ATOM records:

>d1ua6l_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1ua6l_:

• d1ua6l_ first appeared in SCOP 1.67
  
• d1ua6l_ appears in SCOP 1.71
  
• d1ua6l_ appears in the current release, SCOPe 2.08