Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase [64147] (3 proteins) Pfam PF04587 |
Protein ADP-dependent glucokinase [64148] (2 species) |
Species Pyrococcus furiosus [TaxId:2261] [102643] (1 PDB entry) |
Domain d1ua4a_: 1ua4 A: [99128] complexed with amp, bgc, glc |
PDB Entry: 1ua4 (more details), 1.9 Å
SCOPe Domain Sequences for d1ua4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ua4a_ c.72.1.3 (A:) ADP-dependent glucokinase {Pyrococcus furiosus [TaxId: 2261]} ptweelyknaiekaiksvpkvkgvllgyntnidaikyldskdleeriikagkeevikyse elpdkintvsqllgsilwsirrgkaaelfvescpvrfymkrwgwnelrmggqagimanll ggvygvpvivhvpqlsrlqanlfldgpiyvptlengevklihpkefsgdeencihyiyef prgfrvfefeaprenrfigsaddynttlfireefresfseviknvqlailsglqaltken ykepfeivksnlevlnereipvhlefaftpdekvreeilnvlgmfysvglnevelasime ilgekklakellahdpvdpiavteamlklakktgvkrihfhtygyylalteykgehvrda llfaalaaaakamkgnitsleeireatsvpvnekatqveeklraeygikegigevegyqi afiptkivakpkstvgigdtisssafigefsftl
Timeline for d1ua4a_: