Lineage for d1ua4a_ (1ua4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904492Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase [64147] (3 proteins)
    Pfam PF04587
  6. 2904493Protein ADP-dependent glucokinase [64148] (2 species)
  7. 2904494Species Pyrococcus furiosus [TaxId:2261] [102643] (1 PDB entry)
  8. 2904495Domain d1ua4a_: 1ua4 A: [99128]
    complexed with amp, bgc, glc

Details for d1ua4a_

PDB Entry: 1ua4 (more details), 1.9 Å

PDB Description: crystal structure of an adp-dependent glucokinase from pyrococcus furiosus
PDB Compounds: (A:) ADP-dependent glucokinase

SCOPe Domain Sequences for d1ua4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua4a_ c.72.1.3 (A:) ADP-dependent glucokinase {Pyrococcus furiosus [TaxId: 2261]}
ptweelyknaiekaiksvpkvkgvllgyntnidaikyldskdleeriikagkeevikyse
elpdkintvsqllgsilwsirrgkaaelfvescpvrfymkrwgwnelrmggqagimanll
ggvygvpvivhvpqlsrlqanlfldgpiyvptlengevklihpkefsgdeencihyiyef
prgfrvfefeaprenrfigsaddynttlfireefresfseviknvqlailsglqaltken
ykepfeivksnlevlnereipvhlefaftpdekvreeilnvlgmfysvglnevelasime
ilgekklakellahdpvdpiavteamlklakktgvkrihfhtygyylalteykgehvrda
llfaalaaaakamkgnitsleeireatsvpvnekatqveeklraeygikegigevegyqi
afiptkivakpkstvgigdtisssafigefsftl

SCOPe Domain Coordinates for d1ua4a_:

Click to download the PDB-style file with coordinates for d1ua4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ua4a_: