Lineage for d1t5ja_ (1t5j A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450540Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 450541Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (1 family) (S)
  5. 450542Family a.209.1.1: ADP-ribosylglycohydrolase [101479] (1 protein)
    Pfam 03747
  6. 450543Protein Hypothetical protein MJ1187 [101480] (1 species)
  7. 450544Species Archaeon Methanococcus jannaschii [TaxId:2190] [101481] (1 PDB entry)
  8. 450545Domain d1t5ja_: 1t5j A: [99125]

Details for d1t5ja_

PDB Entry: 1t5j (more details), 2.7 Å

PDB Description: crystal structure of ribosylglycohydrolase mj1187 from methanococcus jannaschii

SCOP Domain Sequences for d1t5ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5ja_ a.209.1.1 (A:) Hypothetical protein MJ1187 {Archaeon Methanococcus jannaschii}
lvkmrdkilgsvfgavigdalgmptenltkeeikklygfvdsyvepknylagklnkgewt
ddteqaicliksltkegidikkfancliawknknppdigltslmaidklenndysgvdss
scgaamriyplgivfhnnlkklkeevikaskithnnktaiagalaiaffvssalkdrkdf
slldecynyikdideefakklleiknfnnldyiydyfgtgvktdevvpsaiatylltdnf
kegmlkcinaggdtdslasmygamagayygfknipkewidglknkevifelaerlyhlat
e

SCOP Domain Coordinates for d1t5ja_:

Click to download the PDB-style file with coordinates for d1t5ja_.
(The format of our PDB-style files is described here.)

Timeline for d1t5ja_: