Lineage for d1t5ja1 (1t5j A:2-301)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736587Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 2736588Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) (S)
  5. 2736589Family a.209.1.1: ADP-ribosylglycohydrolase [101479] (1 protein)
    Pfam PF03747
  6. 2736590Protein Hypothetical protein MJ1187 [101480] (1 species)
  7. 2736591Species Methanococcus jannaschii [TaxId:2190] [101481] (1 PDB entry)
  8. 2736592Domain d1t5ja1: 1t5j A:2-301 [99125]
    Other proteins in same PDB: d1t5ja2
    complexed with mg

Details for d1t5ja1

PDB Entry: 1t5j (more details), 2.7 Å

PDB Description: crystal structure of ribosylglycohydrolase mj1187 from methanococcus jannaschii
PDB Compounds: (A:) Hypothetical protein MJ1187

SCOPe Domain Sequences for d1t5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5ja1 a.209.1.1 (A:2-301) Hypothetical protein MJ1187 {Methanococcus jannaschii [TaxId: 2190]}
vkmrdkilgsvfgavigdalgmptenltkeeikklygfvdsyvepknylagklnkgewtd
dteqaicliksltkegidikkfancliawknknppdigltslmaidklenndysgvdsss
cgaamriyplgivfhnnlkklkeevikaskithnnktaiagalaiaffvssalkdrkdfs
lldecynyikdideefakklleiknfnnldyiydyfgtgvktdevvpsaiatylltdnfk
egmlkcinaggdtdslasmygamagayygfknipkewidglknkevifelaerlyhlate

SCOPe Domain Coordinates for d1t5ja1:

Click to download the PDB-style file with coordinates for d1t5ja1.
(The format of our PDB-style files is described here.)

Timeline for d1t5ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t5ja2