Lineage for d1t3ua_ (1t3u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008639Fold d.244: Cell division protein ZapA-like [102828] (1 superfamily)
    core: beta(2)-alpha(2), 2 layers: alpha/beta; long C-terminal helix forms dimeric parallel and tetrameric antiparallel coiled coils
  4. 3008640Superfamily d.244.1: Cell division protein ZapA-like [102829] (2 families) (S)
    automatically mapped to Pfam PF05164
  5. 3008641Family d.244.1.1: Cell division protein ZapA-like [102830] (1 protein)
    Pfam PF05164; ZapA is a Z-ring associated protein first discovered in B. subtilis (formerly hypothetical protein YshA);
  6. 3008642Protein ZapA homologue PA5227 [102831] (1 species)
  7. 3008643Species Pseudomonas aeruginosa [TaxId:287] [102832] (2 PDB entries)
    Uniprot Q9HTW3
  8. 3008644Domain d1t3ua_: 1t3u A: [99120]
    structural genomics

Details for d1t3ua_

PDB Entry: 1t3u (more details), 2.5 Å

PDB Description: unknown conserved bacterial protein from pseudomonas aeruginosa pao1
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ua_ d.244.1.1 (A:) ZapA homologue PA5227 {Pseudomonas aeruginosa [TaxId: 287]}
tltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaalnithd
llhrkerldqessstrervrelldrvdralan

SCOPe Domain Coordinates for d1t3ua_:

Click to download the PDB-style file with coordinates for d1t3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1t3ua_: