SCOP 1.75: Domain d1t3hc_: 1t3h C:

Lineage for d1t3hc_ (1t3h C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Dephospho-CoA kinase [75187] (3 species)

7. Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)

8. Domain d1t3hc_: 1t3h C: [99119]
   structural genomics; NESG target ER57
   complexed with so4

Details for d1t3hc_

PDB Entry: 1t3h, 2.5 Å

PDB Description: X-ray Structure of Dephospho-CoA Kinase from E. coli Norteast Structural Genomics Consortium Target ER57

PDB Compounds: (C:) dephospho-coa kinase

SCOP Domain Sequences for d1t3hc_:

Sequence, based on SEQRES records:

>d1t3hc_ c.37.1.1 (C:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqfvsqekpe

Sequence, based on observed residues (ATOM records):

>d1t3hc_ c.37.1.1 (C:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmee
knwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetqlkr
tmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqf
vsqekpe

Timeline for d1t3hc_:

• d1t3hc_ first appeared in SCOP 1.67
  
• d1t3hc_ appears in SCOP 1.73
  
• d1t3hc_ appears in SCOPe 2.01
  
• d1t3hc_ appears in the current release, SCOPe 2.08, called d1t3hc1