Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.129: Putative lysine decarboxylase [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
Superfamily c.129.1: Putative lysine decarboxylase [102405] (1 family) |
Family c.129.1.1: Putative lysine decarboxylase [102406] (2 proteins) Pfam 03641 |
Protein Hypothetical protein YvdD [102409] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102410] (1 PDB entry) |
Domain d1t35d_: 1t35 D: [99111] |
PDB Entry: 1t35 (more details), 2.72 Å
SCOP Domain Sequences for d1t35d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t35d_ c.129.1.1 (D:) Hypothetical protein YvdD {Bacillus subtilis} mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny
Timeline for d1t35d_: