Lineage for d1t35d_ (1t35 D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405086Fold c.129: Putative lysine decarboxylase [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 405087Superfamily c.129.1: Putative lysine decarboxylase [102405] (1 family) (S)
  5. 405088Family c.129.1.1: Putative lysine decarboxylase [102406] (2 proteins)
    Pfam 03641
  6. 405095Protein Hypothetical protein YvdD [102409] (1 species)
  7. 405096Species Bacillus subtilis [TaxId:1423] [102410] (1 PDB entry)
  8. 405100Domain d1t35d_: 1t35 D: [99111]

Details for d1t35d_

PDB Entry: 1t35 (more details), 2.72 Å

PDB Description: crystal structure of a hypothetical protein yvdd- a putative lysine decarboxylase

SCOP Domain Sequences for d1t35d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t35d_ c.129.1.1 (D:) Hypothetical protein YvdD {Bacillus subtilis}
mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta
igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw
aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqny

SCOP Domain Coordinates for d1t35d_:

Click to download the PDB-style file with coordinates for d1t35d_.
(The format of our PDB-style files is described here.)

Timeline for d1t35d_: