SCOP 1.67: Domain d1t2ve1: 1t2v E:1649-1757

Lineage for d1t2ve1 (1t2v E:1649-1757)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (4 families)

5. Family c.15.1.3: Breast cancer associated protein, BRCA1 [63955] (1 protein)

6. Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
   duplication: tandem repeat of BRCT domain

7. Species Human (Homo sapiens) [TaxId:9606] [63957] (6 PDB entries)

8. Domain d1t2ve1: 1t2v E:1649-1757 [99106]

Details for d1t2ve1

PDB Entry: 1t2v, 3.3 Å

PDB Description: Structural basis of phospho-peptide recognition by the BRCT domain of BRCA1, structure with phosphopeptide

SCOP Domain Sequences for d1t2ve1:

Sequence; same for both SEQRES and ATOM records:

>d1t2ve1 c.15.1.3 (E:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens)}
rmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgia
ggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqd

Timeline for d1t2ve1:

• d1t2ve1 is new in SCOP 1.67
  
• d1t2ve1 appears in SCOP 1.69
  
• d1t2ve1 appears in the current release, SCOPe 2.08