Lineage for d1t2va1 (1t2v A:1649-1757)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1836776Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1836777Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 1836806Family c.15.1.3: BRCT domain [63955] (1 protein)
  6. 1836807Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
    duplication: tandem repeat of BRCT domain
  7. 1836808Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
    Uniprot P38398 1649-1863
  8. 1836847Domain d1t2va1: 1t2v A:1649-1757 [99098]

Details for d1t2va1

PDB Entry: 1t2v (more details), 3.3 Å

PDB Description: Structural basis of phospho-peptide recognition by the BRCT domain of BRCA1, structure with phosphopeptide
PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d1t2va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2va1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
rmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgia
ggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqd

SCOPe Domain Coordinates for d1t2va1:

Click to download the PDB-style file with coordinates for d1t2va1.
(The format of our PDB-style files is described here.)

Timeline for d1t2va1: