Lineage for d1t2fd2 (1t2f D:161-332)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680355Protein Lactate dehydrogenase [56339] (19 species)
  7. 1680400Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [64444] (2 PDB entries)
  8. 1680406Domain d1t2fd2: 1t2f D:161-332 [99095]
    Other proteins in same PDB: d1t2fa1, d1t2fb1, d1t2fc1, d1t2fd1
    complexed with nad, oxq

Details for d1t2fd2

PDB Entry: 1t2f (more details), 3 Å

PDB Description: human b lactate dehydrogenase complexed with nad+ and 4-hydroxy-1,2,5- oxadiazole-3-carboxylic acid
PDB Compounds: (D:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d1t2fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2fd2 d.162.1.1 (D:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}
sgcnldsarfrylmaeklgihpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvkgm
ygienevflslpcilnargltsvinqklkddevaqlkksadtlwdiqkdlkf

SCOPe Domain Coordinates for d1t2fd2:

Click to download the PDB-style file with coordinates for d1t2fd2.
(The format of our PDB-style files is described here.)

Timeline for d1t2fd2: